DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and zgc:92590

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001007055.1 Gene:zgc:92590 / 474322 ZFINID:ZDB-GENE-041024-15 Length:247 Species:Danio rerio


Alignment Length:239 Identity:78/239 - (32%)
Similarity:124/239 - (51%) Gaps:20/239 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHC--VENAFIPWLVVVTGT-N 96
            |.:||||........|:||.|...:|...||.::||:.:.::||||  |.|.    |.|..|. |
Zfish    18 DDKIIGGYECSPNSQPWQIYLTYDNGQRWCGASLINDRWAVSAAHCYLVANR----LTVHLGEHN 78

  Fly    97 KYNQPGGRYFLKAIHI--HCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILT 159
            ...:.|....:||..:  |..|::..:.||..|::|.||..:::..||:||.......|::.:::
Zfish    79 VAVEEGTEQRIKAEKVIPHPKYNDYTLDNDFMLIKLKEPAVFNQYVQPVPLTTSCSSEGEQCLVS 143

  Fly   160 GWGSTVLWG-TSPIDLQVLYLQYVPHRECKAL----LSNDEDCDVGHICTFSRLGEGACHGDSGG 219
            |||:.:..| ..|..||.|.|..:...:|:..    ::.:..|     ..|...|:.||.|||||
Zfish   144 GWGNLINTGVVYPDVLQCLNLPVLTRAQCEGAYGWQITKNMFC-----AGFMEGGKDACQGDSGG 203

  Fly   220 PLVSNGYLVGLVNWGWPCA-TGVPDVHASVYFYRDWIRNVMSGN 262
            |::.||.|.|:|:||:.|| :|.|.|:..|..|.||:.:.::.|
Zfish   204 PVICNGELRGVVSWGYGCADSGYPGVYTEVCRYTDWVASTIANN 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 75/228 (33%)
Tryp_SPc 38..258 CDD:238113 76/230 (33%)
zgc:92590NP_001007055.1 Tryp_SPc 20..240 CDD:214473 75/228 (33%)
Tryp_SPc 21..243 CDD:238113 76/230 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.