DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP012671

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_001230557.2 Gene:AgaP_AGAP012671 / 4578478 VectorBaseID:AGAP012671 Length:216 Species:Anopheles gambiae


Alignment Length:198 Identity:56/198 - (28%)
Similarity:78/198 - (39%) Gaps:33/198 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 HSCGGAIINETFVLTAAHCV-ENAFIPWLVVVTGTNKYNQPGGRYF-LKAIHIHCNYDN---PEM 121
            ::.|..||.....||||||| .....|..|.:.|.:.....||..| :..|.:|..||:   |:.
Mosquito     8 YAVGATIITHKHALTAAHCVYPQRSEPMRVSLYGGSTSAVTGGVLFSVVRIAVHPGYDHSYFPDA 72

  Fly   122 HN-DIALLELVEPIAWDERTQPIPLPL-VPMQP-GDEVILTGWGSTVLWGTSPIDLQVLYLQYVP 183
            .. |:|:|.:... |:..::....|.| ...|| |....:.|||.|  ....|..|..|      
Mosquito    73 SEYDVAVLTVANN-AFSGKSNMASLILQTSEQPIGTRCFVAGWGRT--GNNEPASLNQL------ 128

  Fly   184 HRECKALLSNDEDCDVG------HICTFSRLGEG--ACHGDSGGPLVSNGYLVGLVNW------- 233
             |..:..:.:...|...      ...|..:.|.|  .|.|||||.||..|.|.|:|::       
Mosquito   129 -RYAEMTIVDQSTCARAWATYPRQRVTSKKYGNGVDTCKGDSGGALVCGGGLAGVVSFTNLECTS 192

  Fly   234 GWP 236
            .||
Mosquito   193 AWP 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 56/198 (28%)
Tryp_SPc 38..258 CDD:238113 56/198 (28%)
AgaP_AGAP012671XP_001230557.2 Tryp_SPc 11..203 CDD:214473 56/195 (29%)
Tryp_SPc 11..202 CDD:238113 56/195 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.