DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CLIPB18

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_001238237.1 Gene:CLIPB18 / 4578288 VectorBaseID:AGAP009215 Length:359 Species:Anopheles gambiae


Alignment Length:251 Identity:68/251 - (27%)
Similarity:112/251 - (44%) Gaps:34/251 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 YKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVV----VT 93
            |...|:..||.|.....|:...|...|....|||.:||..:|||||||::|..:..:.:    ::
Mosquito   109 YSADRMAYGQEARLFQFPWMALLMLNSVKFVCGGTLINRRYVLTAAHCLKNTQVTTVRLGEFDIS 173

  Fly    94 GTNKYNQPGGRY-------FLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQ 151
            ....|::.|.::       .::...:|..|......|||.|:.:.|..|:::...||.||:.|..
Mosquito   174 TPIDYDKRGDQHAPPPQDIAIEQTIVHEAYSTRLKVNDIGLIRMAEEAAYNDNVSPICLPVSPAM 238

  Fly   152 PGDEV--ILTGWGST--------VLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICTFS 206
            ...:.  .:.|||:|        :|:|...:.......|::...:....::||:.|.:|...|.:
Mosquito   239 RTTQTTYFVAGWGATESAFYSNRLLFGKVALLTNDQCAQHLLRVDSYTKINNDQMCAIGANLTDN 303

  Fly   207 RLGEGACHGDSGGPL----VSNGYL-VGLVNWGW-PCA-TGVPDVHASVYFYRDWI 255
                  |.|||||||    ::..|: .|:|:.|. .|. ...|.|:..|..|.|||
Mosquito   304 ------CTGDSGGPLKTISINARYVQYGVVSLGLRTCGKQSAPGVYTRVENYADWI 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 65/245 (27%)
Tryp_SPc 38..258 CDD:238113 66/246 (27%)
CLIPB18XP_001238237.1 Tryp_SPc 117..356 CDD:238113 66/243 (27%)
Tryp_SPc 117..353 CDD:214473 64/241 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.