DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP010614

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_001237580.2 Gene:AgaP_AGAP010614 / 4577723 VectorBaseID:AGAP010614 Length:266 Species:Anopheles gambiae


Alignment Length:259 Identity:73/259 - (28%)
Similarity:111/259 - (42%) Gaps:19/259 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCG 65
            |..|:.|:|.||....::.......|..||. .:..||:.|:|.......|.:||: ::|...||
Mosquito     1 MKQVISLVLFGLFCGSAVLTDASDQNKPDGA-SQSGRIVNGKAVSIVKYKYALSLR-VNGVFDCG 63

  Fly    66 GAIINETFVLTAAHCV-ENAFIPWLVVVTGTNKYNQPGG-RYFLKAIHIHCNYDN---PEMHN-D 124
            ..||..:..||||||| :....|..|.:.|.:.....|| ...:.:|.:|.||:.   |...: |
Mosquito    64 ATIITNSHSLTAAHCVYKYPSDPSRVTLYGGSTSTSSGGIEVPVVSIALHPNYNRKAFPAASDCD 128

  Fly   125 IALLEL-VEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTSPIDL-QVLY--LQYVPHR 185
            :|:|.: |...:......|:.|....:..|.|..:.|||.|  ....|..: |:.|  :..|...
Mosquito   129 VAVLNVPVNSFSGRPNMAPLALQTNELPVGTECFVIGWGRT--GNNQPASVNQLRYANMNIVSQS 191

  Fly   186 ECKALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWGWP-CATGVPDVHASV 248
            .|..:.:...:.    ||.....|...|.|||||.||....|.|:|::..| |.:..|...|.:
Mosquito   192 TCATMWAEYRNM----ICAKYNNGVDTCGGDSGGALVCGSGLAGVVSFSHPNCTSAWPAGFAKI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 64/223 (29%)
Tryp_SPc 38..258 CDD:238113 63/222 (28%)
AgaP_AGAP010614XP_001237580.2 Tryp_SPc 36..253 CDD:214473 64/223 (29%)
Tryp_SPc 37..262 CDD:238113 63/222 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.