DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP010619

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_001230717.2 Gene:AgaP_AGAP010619 / 4577722 VectorBaseID:AGAP010619 Length:280 Species:Anopheles gambiae


Alignment Length:302 Identity:75/302 - (24%)
Similarity:115/302 - (38%) Gaps:81/302 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VLLILLGLSGLVSI---------TAIRIKG-NSTDGR-FYKDQRIIGGQAAEDGFAPYQISLQGI 58
            ::::.|..|.:||.         .|:.:|. |.|:.. ..:..|||.|.|::....|:.||::. 
Mosquito     7 LVILCLFYSNVVSANGNEKATAEAAVLVKAENVTEAEAAAQSGRIINGFASDIANYPFAISVRR- 70

  Fly    59 SGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVT---GTNKYNQPGGRYF---LKAIHIHCNYD 117
            .|...|||.:|:.::.||||..|    .|:...:|   |:...|. ||..|   :.|:|:..|.:
Mosquito    71 DGQFYCGGTVISASYALTAATPV----YPYRNSITLYGGSTSANS-GGVLFKVLMIAVHLLFNPN 130

  Fly   118 NPEMHNDIALLEL----------VEPI----------------AWDERTQPIPLPLVPMQPGDEV 156
            :.....:||:|.:          :.||                .|......:|.|...::..|.|
Mosquito   131 DRVSDYNIAILTVPANAFGGRRNIAPIPLASAEVAIGTKCTVFGWGRTNANLPGPANALRSADMV 195

  Fly   157 ILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICTFSRLGEGACHGDSGGPL 221
            |.:|......||  |:.:|              |.||       .||.....|...|.||.|..|
Mosquito   196 ISSGATCARAWG--PLSVQ--------------LTSN-------MICAKGVRGADLCIGDYGNAL 237

  Fly   222 VSNGYLVGLVNWGWPCATGVPDVHASVYF------YRDWIRN 257
            |..|.|.|:.....|   |..:...|||.      .|.:||:
Mosquito   238 VCRGKLNGIAFLASP---GCDNTRDSVYMRITEYNIRRFIRS 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 65/255 (25%)
Tryp_SPc 38..258 CDD:238113 66/258 (26%)
AgaP_AGAP010619XP_001230717.2 Tryp_SPc 50..268 CDD:214473 64/249 (26%)
Tryp_SPc 51..268 CDD:238113 63/248 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.