DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP012036

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_552175.3 Gene:AgaP_AGAP012036 / 4577673 VectorBaseID:AGAP012036 Length:370 Species:Anopheles gambiae


Alignment Length:231 Identity:60/231 - (25%)
Similarity:101/231 - (43%) Gaps:37/231 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 CGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFLKAIH----------------- 111
            |.|.:|.|.:||||||||.|..:.:.:......:.....|.:.:..:.                 
Mosquito   139 CVGTLIQERYVLTAAHCVHNLIVSFSLQCLFLRRIKLYFGLFLISTLGQCLADRVCQERRAAELI 203

  Fly   112 IHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDE------VILTGWGSTVLWGTS 170
            :|.:|::....|||||:.:.|.:.:.:..:|..||...:  .||      |:..|||. ...||.
Mosquito   204 VHQDYNSHARLNDIALIRVSEAVQFTQDVRPACLPFNYL--FDESLASPRVLSLGWGE-YQQGTM 265

  Fly   171 PIDLQVLYLQYVPHRECKALLSNDEDCDVGHI----CTFSRL-GEGACHGDSGGPLV----SNGY 226
            ....:::.|:.:...||...|...:..::..|    ||...| |:..|.||||.|:|    ...:
Mosquito   266 SDSKRIVQLEIIKEDECGDQLKKWQRFNISMISSVMCTVGVLAGQDVCEGDSGAPIVQIRNDRYF 330

  Fly   227 LVGLVNWGWPC--ATGVPDVHASVYFYRDWIRNVMS 260
            ::|:|::|..|  .||...:...|..|::||...|:
Mosquito   331 VIGVVSFGPKCGMGTGTAGMSTRVSEYKNWILTSMN 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 57/224 (25%)
Tryp_SPc 38..258 CDD:238113 59/227 (26%)
AgaP_AGAP012036XP_552175.3 CLIP 28..83 CDD:288855
Tryp_SPc 122..361 CDD:214473 57/224 (25%)
Tryp_SPc 122..361 CDD:238113 57/224 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.