DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and prtn3

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001006847.1 Gene:prtn3 / 448597 XenbaseID:XB-GENE-5805214 Length:245 Species:Xenopus tropicalis


Alignment Length:265 Identity:82/265 - (30%)
Similarity:128/265 - (48%) Gaps:35/265 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIIN 70
            ||:.|.:     :.|.::.|.|      ...:|:||:.|.....||..||| :.|.|.|||::|.
 Frog     5 LLVTLSI-----LWASQVNGGS------MHTQIVGGREATPNSHPYIASLQ-LRGRHFCGGSLIA 57

  Fly    71 ETFVLTAAHCVENAFIPWLVVVTGTN--KYNQPGGRYFLKAIHIHCNYDNP-EMHNDIALLELVE 132
            ..|::|||||:||.....:.||.|.:  :.|:...:.| :...:..|..|| .:.|||.:|:|..
 Frog    58 PQFLMTAAHCMENTASNLVTVVLGAHSLRANEATKQRF-RVNQVFENGFNPLTLQNDIVILKLDR 121

  Fly   133 PIAWDERTQPIPLPL----VPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSN 193
            |::.:.:.|.:.||.    ||  .|.:.:..|||.....|..|..||          |....::.
 Frog   122 PVSLNGKVQVVSLPSANEDVP--AGTQCVTAGWGRLSTEGQIPDRLQ----------ELNVTVTR 174

  Fly   194 DEDCDVGHICTFSRLGE-GACHGDSGGPLVSNGYLVGLVNW-GWPCATGV-PDVHASVYFYRDWI 255
            ...|...:|||...:.: |.|.||||||||.||.:.|:.:: ...|..|| ||..:.|..:|.:|
 Frog   175 QNLCRPNNICTGVFMQQAGICFGDSGGPLVCNGVIQGITSFIIRSCGNGVTPDFFSRVSLFRRFI 239

  Fly   256 RNVMS 260
            .:.::
 Frog   240 DDAIN 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 75/227 (33%)
Tryp_SPc 38..258 CDD:238113 76/229 (33%)
prtn3NP_001006847.1 Tryp_SPc 26..241 CDD:238113 76/228 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.