DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and pafah1b3

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001006715.1 Gene:pafah1b3 / 448360 XenbaseID:XB-GENE-485956 Length:226 Species:Xenopus tropicalis


Alignment Length:138 Identity:30/138 - (21%)
Similarity:46/138 - (33%) Gaps:40/138 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GNSTDGRFYKDQRIIGGQAAEDGFAPYQISL------QGISGAHSCGGAIINETFVLTAAHCVEN 83
            |..:||..:...|:..|:.  |...|..|.|      ||.|.....||       :|....|:..
 Frog    72 GGLSDGTQHVLWRLENGEL--DHVKPKIIVLWVGTYNQGHSAEQIAGG-------ILAIVRCIYQ 127

  Fly    84 AFIPWLVVVTGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLP-- 146
                           .||..:..:.|:.......||..:.::.:.:|:      |.|.| .||  
 Frog   128 ---------------RQPQAKVIVMALLPRGKNPNPLRNRNLQVNKLL------EETLP-SLPNA 170

  Fly   147 -LVPMQPG 153
             |:...||
 Frog   171 FLLDADPG 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 27/126 (21%)
Tryp_SPc 38..258 CDD:238113 26/125 (21%)
pafah1b3NP_001006715.1 PAF_acetylesterase_like 8..217 CDD:238858 30/138 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.