DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and prss3

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001004941.1 Gene:prss3 / 448342 XenbaseID:XB-GENE-6372192 Length:249 Species:Xenopus tropicalis


Alignment Length:236 Identity:80/236 - (33%)
Similarity:125/236 - (52%) Gaps:20/236 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIP-WLVVVTGTNKY 98
            |.||:||........|:|:.| ...|:..|||::|...::::||||.   .:| ::|...|.:..
 Frog    20 DSRIVGGYECAPHSKPWQVHL-NYKGSFFCGGSLIAPRWIVSAAHCY---LLPKYVVAHIGMHDV 80

  Fly    99 NQPGGRYFLKAIHI-----HCNYDNPEMHNDIALLELVEPIAWDERTQPIPLP-LVPMQPGDEVI 157
            ::..|.  ::.|.:     |..|::..:.|||.|::|.||..::...|||||. ..||: |...:
 Frog    81 SKAEGT--VQIIQVEKSFQHYKYNSSNIDNDIMLIKLAEPAQFNHHVQPIPLAHSCPMK-GTRCV 142

  Fly   158 LTGWGS--TVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICT-FSRLGEGACHGDSGG 219
            ::|:|:  ...:|..|..||.|.|..:|...||:  |..:|......|. |...|:.:|.|||||
 Frog   143 VSGYGNMRPGFFGEFPDRLQCLDLPVLPEDSCKS--SYGDDITNNMFCAGFQEGGKDSCQGDSGG 205

  Fly   220 PLVSNGYLVGLVNWGWPCA-TGVPDVHASVYFYRDWIRNVM 259
            |||.:|.|.|:|:||..|| .|.|.|:..|..|.||:.::|
 Frog   206 PLVCDGELFGVVSWGHECAKKGYPGVYTKVCHYIDWVNDIM 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 77/228 (34%)
Tryp_SPc 38..258 CDD:238113 77/230 (33%)
prss3NP_001004941.1 Tryp_SPc 23..245 CDD:238113 77/230 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.