DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP012778

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_001230340.2 Gene:AgaP_AGAP012778 / 4397620 VectorBaseID:AGAP012778 Length:276 Species:Anopheles gambiae


Alignment Length:288 Identity:86/288 - (29%)
Similarity:124/288 - (43%) Gaps:62/288 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SAVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQG--ISG--AH 62
            |.|.|..||.|       |::....|        ||||||.|..   ||..:...|  ::|  ::
Mosquito    22 SGVALACLLPL-------AVQADAGS--------QRIIGGSAVT---APSWMVAVGEVVNGNWSN 68

  Fly    63 SCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFLKAIHIHCNY----------- 116
            .|||.:|::.:||||||||.||....:.|..|.:..::|..|..:..:.:|..|           
Mosquito    69 FCGGTLIDKQWVLTAAHCVANAQSGPMEVAIGVSDLSRPHTRSKVDQVLMHPEYYVNLLSNLGYR 133

  Fly   117 DNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVL----WG--------T 169
            :.| ..:|:|||.|..|:     || .|:.:..:...|   ...|.:|:|    :|        :
Mosquito   134 ETP-YSSDVALLHLATPV-----TQ-APIVMADITTKD---TWQWNTTMLHAIGYGGINPDATKS 188

  Fly   170 SPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWG 234
            || .|..:.|.|...|:...     .|....||......|:..|.|||||||...|.|||:.::|
Mosquito   189 SP-QLLAVDLAYRGERDYWY-----GDPTTTHIFAGKLAGQDTCKGDSGGPLTYGGKLVGVTSYG 247

  Fly   235 -WPCATGVPDVHASVYFYRDWIRNVMSG 261
             :|||||....:.....:.|||.....|
Mosquito   248 AFPCATGSAGGYTYAPAFSDWIVGQQQG 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 74/245 (30%)
Tryp_SPc 38..258 CDD:238113 75/247 (30%)
AgaP_AGAP012778XP_001230340.2 Tryp_SPc 42..269 CDD:214473 74/245 (30%)
Tryp_SPc 43..269 CDD:238113 73/244 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.