DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and KLK12

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_062544.1 Gene:KLK12 / 43849 HGNCID:6360 Length:254 Species:Homo sapiens


Alignment Length:278 Identity:84/278 - (30%)
Similarity:114/278 - (41%) Gaps:76/278 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISL-QGISGAHSC 64
            :|..:||.:||||...:                  .:|..|........|:|:.| :|.|  ..|
Human     3 LSIFLLLCVLGLSQAAT------------------PKIFNGTECGRNSQPWQVGLFEGTS--LRC 47

  Fly    65 GGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQ----------------PGGRYFLKAIHIH 113
            ||.:|:..:|||||||..:.:  |  |..|.:..:|                ||   :|.|...|
Human    48 GGVLIDHRWVLTAAHCSGSRY--W--VRLGEHSLSQLDWTEQIRHSGFSVTHPG---YLGASTSH 105

  Fly   114 CNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTSPID----- 173
                    .:|:.||.|..|:......||:|||......|.|..::|||.|    ..|.:     
Human   106 --------EHDLRLLRLRLPVRVTSSVQPLPLPNDCATAGTECHVSGWGIT----NHPRNPFPDL 158

  Fly   174 LQVLYLQYVPHRECKA-----LLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNW 233
            ||.|.|..|.|..|..     :.||       .:|.....|:.||.||||||||..|.|.|||:|
Human   159 LQCLNLSIVSHATCHGVYPGRITSN-------MVCAGGVPGQDACQGDSGGPLVCGGVLQGLVSW 216

  Fly   234 G--WPCA-TGVPDVHASV 248
            |  .||. .|:|.|:..:
Human   217 GSVGPCGQDGIPGVYTYI 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 77/242 (32%)
Tryp_SPc 38..258 CDD:238113 77/241 (32%)
KLK12NP_062544.1 Tryp_SPc 21..236 CDD:214473 77/242 (32%)
Tryp_SPc 22..236 CDD:238113 77/241 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.