DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Try10

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001034085.1 Gene:Try10 / 436522 MGIID:3687012 Length:246 Species:Mus musculus


Alignment Length:268 Identity:88/268 - (32%)
Similarity:136/268 - (50%) Gaps:28/268 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCG 65
            ||.::.|.|:|.:....:.              .|.:|:||....:...|||:||.  ||.|.||
Mouse     1 MSTLLFLALVGAAVAFPVD--------------DDDKIVGGYTCRENSVPYQVSLN--SGYHFCG 49

  Fly    66 GAIINETFVLTAAHCVENAFIPWLVVVTGTNKYN-QPGGRYFLKAIHI--HCNYDNPEMHNDIAL 127
            |::||:.:|::||||.::.    :.|..|.:..| ..|...|:.|.:|  |..:....:.|||.|
Mouse    50 GSLINDQWVVSAAHCYKSR----IQVRLGEHNINVLEGNEQFIDAANIIKHPKFKKKTLDNDIML 110

  Fly   128 LELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTSPID-LQVLYLQYVPHRECKALL 191
            ::|..|:..:.|...:.||......|.:.:::|||:|:..|.:..| ||.|....:|..:|:|  
Mouse   111 IKLSSPVTLNARVATVALPSSCAAAGTQCLISGWGNTLSSGVNNPDLLQCLDAPLLPQADCEA-- 173

  Fly   192 SNDEDCDVGHICT-FSRLGEGACHGDSGGPLVSNGYLVGLVNWGWPCA-TGVPDVHASVYFYRDW 254
            |.........||. |...|:.:|.||||||:|.||.|.|:|:||:.|| ...|.|:..|..|.||
Mouse   174 SYPGKITKNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKDNPGVYTKVCNYVDW 238

  Fly   255 IRNVMSGN 262
            |:|.::.|
Mouse   239 IQNTIAAN 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 78/223 (35%)
Tryp_SPc 38..258 CDD:238113 80/225 (36%)
Try10NP_001034085.1 Tryp_SPc 23..239 CDD:214473 78/223 (35%)
Tryp_SPc 24..242 CDD:238113 80/225 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.