DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG11313

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster


Alignment Length:220 Identity:66/220 - (30%)
Similarity:103/220 - (46%) Gaps:30/220 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 CGGAIINETFVLTAAHCVENAF------IPWLVVVTGTNKYNQP------GGRYF-------LKA 109
            |.|::||..:|:||||||..|.      :.:.|.|. ..::|..      .||..       ::.
  Fly   147 CAGSLINNRYVVTAAHCVSAATRARKGDVSFRVSVR-LGEHNTSAVVDCLNGRCLPEPVQIAVEE 210

  Fly   110 IHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLP----LVPMQPGDEVILTGWGSTVLWGTS 170
            |.||.::......|||||:.|...:|:....:|:.||    |...|.|....:.|||.|:...:|
  Fly   211 IRIHESFGTRLFWNDIALIRLAREVAYSPSIRPVCLPSTVGLQNWQSGQAFTVAGWGRTLTSESS 275

  Fly   171 PIDLQVLYLQYVPHRECKALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVS--NGYLV--GLV 231
            |:.:: |.:.||....|:...::.......|:|...|....:|.|||||||::  .|..|  |:|
  Fly   276 PVKMK-LRVTYVEPGLCRRKYASIVVLGDSHLCAEGRSRGDSCDGDSGGPLMAFHEGVWVLGGIV 339

  Fly   232 NWGWPCATGV-PDVHASVYFYRDWI 255
            ::|..|.:.. |.|:.:|..|..||
  Fly   340 SFGLNCGSRFWPAVYTNVLSYETWI 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 64/218 (29%)
Tryp_SPc 38..258 CDD:238113 66/220 (30%)
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 66/220 (30%)
Tryp_SPc 116..364 CDD:214473 64/218 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.