DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Jon99Fi

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster


Alignment Length:290 Identity:86/290 - (29%)
Similarity:130/290 - (44%) Gaps:69/290 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLILLGLSGLVSITAI---------------RIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISL 55
            ||:.|.|: :.:.|||               :|:|           ||..|..|.:|..||.:.|
  Fly     3 LLVFLALA-VAAATAIPTPEQKLVPTPVKDVKIQG-----------RITNGYPAYEGKVPYIVGL 55

  Fly    56 --QGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQP------GGRYFLKAIHI 112
              .| :|...|||:||..|:|||||||...|  ..:.:..|.:..|||      |...|::    
  Fly    56 LFSG-NGNWWCGGSIIGNTWVLTAAHCTNGA--SGVTINYGASLRNQPQYTHWVGSGNFVQ---- 113

  Fly   113 HCNYDNPEMHNDIALLEL-----------VEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVL 166
            |.:|::..:||||:|:..           ||..::::|.|.        ..|...:.:|||.|..
  Fly   114 HHHYNSGNLHNDISLIRTPHVDFWHLVNKVELPSYNDRYQD--------YAGWWAVASGWGGTYD 170

  Fly   167 WGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSN--GYLVG 229
            ....|..||.:.:|.:...:|....|..::.    ||..:..|:..|.||||||||::  ..|||
  Fly   171 GSPLPDWLQAVDVQIMSQSDCSRTWSLHDNM----ICINTNGGKSTCGGDSGGPLVTHEGNRLVG 231

  Fly   230 LVNW--GWPCATGVPDVHASVYFYRDWIRN 257
            :.::  ...|.:|.|.|.:.|..|.||||:
  Fly   232 VTSFVSSAGCQSGAPAVFSRVTGYLDWIRD 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 74/240 (31%)
Tryp_SPc 38..258 CDD:238113 76/243 (31%)
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 74/240 (31%)
Tryp_SPc 38..262 CDD:238113 76/243 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.