DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG9737

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:282 Identity:80/282 - (28%)
Similarity:119/282 - (42%) Gaps:69/282 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQP 101
            ||.||:.||....|:...|...|..:.|.||:|::..:|||||||:           |....::.
  Fly   149 RIYGGEIAELDEFPWLALLVYNSNDYGCSGALIDDRHILTAAHCVQ-----------GEGVRDRQ 202

  Fly   102 G------GRYFLKA------------------------IHIHCNYD--NPEMHNDIALLELVEPI 134
            |      |.:.:|.                        ||:|..|.  :...:||||::.|..|:
  Fly   203 GLKHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPV 267

  Fly   135 AWDERTQPIPLP----LVPMQPGDEVILTGWGSTVLWGT------SPIDLQVLYLQYVPHRECKA 189
            ::.....||.||    .:.:..|....::|||.|.|:..      |||.|: |.:.||.:..|..
  Fly   268 SFTHFVMPICLPNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLK-LRIPYVSNENCTK 331

  Fly   190 LLSNDEDCDV----GHICTFSRLGEGACHGDSGGPLV------SNGYLVGLVNWGW-PCA-TGVP 242
            :|   |...|    ..||......:..|.|||||||:      |.....|:|::|: .|. .|.|
  Fly   332 IL---EGFGVRLGPKQICAGGEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFTQCGMAGKP 393

  Fly   243 DVHASVYFYRDWIRNVMSGNSK 264
            .|:.:|..|.|||.:|:....|
  Fly   394 AVYTNVAEYTDWIDSVVQQRKK 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 76/271 (28%)
Tryp_SPc 38..258 CDD:238113 77/273 (28%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 76/271 (28%)
Tryp_SPc 150..409 CDD:238113 77/273 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.