DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Jon99Cii

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster


Alignment Length:273 Identity:83/273 - (30%)
Similarity:128/273 - (46%) Gaps:37/273 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLILLGLSGLVSITAIRIKGNSTDGRFYKD--QRIIGGQAAEDGFAPYQISL--QGISGAHSCGG 66
            |.:.|.|: :.:.||:............||  .||..|..|.:|..||.:.|  .| :|...|||
  Fly     3 LFVFLALA-VAAATAVPAPAQKLTPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSG-NGNWWCGG 65

  Fly    67 AIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFLKAIHI--HCNYDNPEMHNDIALLE 129
            :||..|:|||||||...|  ..:.:..|.:...||...:::.:..|  |.:|::..:||||:|:.
  Fly    66 SIIGNTWVLTAAHCTNGA--SGVTINYGASIRTQPQYTHWVGSGDIIQHHHYNSGNLHNDISLIR 128

  Fly   130 L-----------VEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVP 183
            .           ||..::::|.|.        ..|...:.:|||.|......|..||.:.:|.:.
  Fly   129 TPHVDFWSLVNKVELPSYNDRYQD--------YAGWWAVASGWGGTYDGSPLPDWLQSVDVQIIS 185

  Fly   184 HRECKALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSN--GYLVGLVNWGWP--CATGVPDV 244
            ..:|....|..::.    ||..:..|:..|.||||||||::  ..|||:.::|..  |.:|.|.|
  Fly   186 QSDCSRTWSLHDNM----ICINTDGGKSTCGGDSGGPLVTHDGNRLVGVTSFGSAAGCQSGAPAV 246

  Fly   245 HASVYFYRDWIRN 257
            .:.|..|.||||:
  Fly   247 FSRVTGYLDWIRD 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 73/236 (31%)
Tryp_SPc 38..258 CDD:238113 75/239 (31%)
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 75/239 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.