DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG11842

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster


Alignment Length:269 Identity:67/269 - (24%)
Similarity:109/269 - (40%) Gaps:66/269 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IIGGQAAEDGFAPYQISLQGISGAHS---------CGGAIINETFVLTAAHC-------VENAFI 86
            ||||..|.....|:...|     .|.         |||.:|::..|||||||       |..|.:
  Fly    73 IIGGGPAVPKEFPHAARL-----GHKDENGEVEWFCGGTLISDRHVLTAAHCHYSPQGSVNIARL 132

  Fly    87 PWLVVVTGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQ 151
            ..|..  .||..:.....:.:|....|..:..|.::|||:::.|..|:.:::...|..||....:
  Fly   133 GDLEF--DTNNDDADPEDFDVKDFTAHPEFSYPAIYNDISVVRLSRPVTFNDYKHPACLPFDDGR 195

  Fly   152 PGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRE---------------CKALLSNDEDCDVGH 201
            .|...|..|||.               |:.||..|               |:.....:::...|:
  Fly   196 LGTSFIAIGWGQ---------------LEIVPRTENKKLQKVKLYNYGTRCRITADRNDELPEGY 245

  Fly   202 -----ICTFSRLGEGACHGDSGGPLV-------SNGYLVGLVNWGWPCAT-GVPDVHASVYFYRD 253
                 :|..|...:..|:||||||::       ...:::|:.:.|..|.| .:|.::..|:||.|
  Fly   246 NATTQLCIGSNEHKDTCNGDSGGPVLIYHMDYPCMYHVMGITSIGVACDTPDLPAMYTRVHFYLD 310

  Fly   254 WIRNVMSGN 262
            ||:..::.|
  Fly   311 WIKQQLAKN 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 64/260 (25%)
Tryp_SPc 38..258 CDD:238113 66/263 (25%)
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 66/263 (25%)
Tryp_SPc 73..312 CDD:214473 64/260 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.