DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG11841

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:324 Identity:72/324 - (22%)
Similarity:135/324 - (41%) Gaps:75/324 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGLSGLVSITAIRIKGNSTD---------------------GRFYKD--------- 35
            |.::.|::||    :.|:::..::|.:.|                     ..|:.|         
  Fly     3 MQSLELILLL----VFSLSSSLVQGQNPDPFAQLACTKFKQIVFEERVAISFFFTDAPITYETVD 63

  Fly    36 ------QRIIGGQAAEDGFAPYQISLQGISGAHS---------CGGAIINETFVLTAAHCVENAF 85
                  ..|:.|..||....|:...|     .|.         |||.:|:...|||||||..:..
  Fly    64 SCHGSRPLIVDGTPAEPKEFPFAARL-----GHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEH 123

  Fly    86 IPWLVVVTGTNKYN------QPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIP 144
            ....||..|..:::      :|.. :.:.|:..|..::||:::|||.:::|...:.::....|..
  Fly   124 GEVNVVRLGELEFDTDTDDAEPED-FGVLALKAHPGFENPQLYNDIGIVQLDREVKFNRYKHPAC 187

  Fly   145 LPLVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGH-----ICT 204
            ||....:..:..|..|||...........|..:.||....|...::.:||| ...|:     :|.
  Fly   188 LPFDDGEQHESFIAIGWGQKKFAQKESKKLLKVQLQGYKDRCVSSVDANDE-LPNGYEPKSQLCI 251

  Fly   205 FSRLGEGACHGDSGGPLVSNG-------YLVGLVNWGWPCAT-GVPDVHASVYFYRDWIRNVMS 260
            .||..:..|:||||||:::..       :::|:.:.|..|:| .:|..:..|:::.:||:..::
  Fly   252 GSRDNKDTCNGDSGGPVLAYHKDLACMYHVMGITSAGITCSTPDIPSAYTRVHYFLNWIKGELA 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 61/245 (25%)
Tryp_SPc 38..258 CDD:238113 63/247 (26%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 62/245 (25%)
Tryp_SPc 72..310 CDD:214473 61/244 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.