DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG4815

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:268 Identity:66/268 - (24%)
Similarity:112/268 - (41%) Gaps:39/268 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LVSITAIRIK-GNSTD--GRFYKDQRIIGGQAAEDGFAPYQISLQGISGAH---------SCGGA 67
            |:.:.::|.: ||..:  |||:  .||..|         .:.:::.:.|..         .|...
  Fly    11 LLILNSVRTEAGNREEWTGRFH--PRIYNG---------IKTTVESLGGVGIQLFNGRKLVCSAT 64

  Fly    68 IINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFLK----AIHIHCNYDNPEMHNDIALL 128
            ::....:||||||.||.......|:.|.:......|..|.|    .:.||..|...:...|:|:.
  Fly    65 LLTPRHILTAAHCFENLNRSKFHVIGGKSAEFTWHGNNFNKNKLIRVQIHPKYAKMKFIADVAVA 129

  Fly   129 ELVEPIAWDERTQPI---PLPLVPMQPGDEVILTGWG-STVLWGTS-PIDLQVLYLQYVPHRECK 188
            :...|:    |::.|   .|....:.|.|::|..||| ...:|..| ....:.:.:..|..|:|:
  Fly   130 KTKYPL----RSKYIGYAQLCRSVLHPRDKLIAAGWGFEGGVWDESRKKTFRSMKVGIVSKRDCE 190

  Fly   189 ALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWGWPCATG-VPDVHASVYFYR 252
            ..|  |.......||..:...:..|.|||||||:....:.|:..|.:.|... .|||:..|.:|.
  Fly   191 KQL--DRKMPPNIICAGAYNNKTLCFGDSGGPLLLGRQVCGINTWTFKCGNNEKPDVYMGVRYYA 253

  Fly   253 DWIRNVMS 260
            .:|:..::
  Fly   254 KFIKRTIN 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 58/236 (25%)
Tryp_SPc 38..258 CDD:238113 58/238 (24%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 55/215 (26%)
Trypsin 49..256 CDD:278516 54/212 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.