DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Tmprss9

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_006513905.2 Gene:Tmprss9 / 432478 MGIID:3612246 Length:1342 Species:Mus musculus


Alignment Length:249 Identity:78/249 - (31%)
Similarity:122/249 - (48%) Gaps:30/249 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKY 98
            |..||:||.:|..|..|:|.||:. ...|.||..::.:.::|:||||..:..:..:....||...
Mouse   753 KPTRIVGGISAVSGEVPWQASLKE-GPRHFCGATVVGDRWLLSAAHCFNHTKVEQVQAHLGTVSL 816

  Fly    99 NQPGG---RYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLV----PMQPGDEV 156
            ...||   :..|:.:.:|..|:...:..|:|||||.:|:.:::..||:.|||.    |:  |.:.
Mouse   817 LGVGGSPVKLGLRRVALHPRYNPGILDFDVALLELAQPLVFNKYIQPVCLPLAIHKFPV--GRKC 879

  Fly   157 ILTGWGSTVLW-GTSPIDLQVLYLQYVPHRECKALLS---NDEDCDVGHICTFSRLGEG---ACH 214
            :::|||:.... .|.|..||...:..:..:.|.||.:   .|.....|.:       ||   :|.
Mouse   880 MISGWGNMQEGNATKPDILQKASVGIIEQKMCGALYNFSLTDRMLCAGFL-------EGRVDSCQ 937

  Fly   215 GDSGGPLVSNG-----YLVGLVNWGWPCATG-VPDVHASVYFYRDWIRNVMSGN 262
            |||||||....     ||.|:|:||..||.. .|.|:|.:...:|||...||.:
Mouse   938 GDSGGPLACEETPGVFYLAGIVSWGIGCAQAKKPGVYARITRLKDWILKAMSSD 991

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 73/237 (31%)
Tryp_SPc 38..258 CDD:238113 74/239 (31%)
Tmprss9XP_006513905.2 SEA 285..365 CDD:366610
LDLa 407..442 CDD:238060
Tryp_SPc 455..684 CDD:214473
Tryp_SPc 756..984 CDD:214473 73/237 (31%)
Tryp_SPc 1085..1336 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.