DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and krt8.1

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001002797.1 Gene:krt8.1 / 431676 XenbaseID:XB-GENE-876929 Length:508 Species:Xenopus tropicalis


Alignment Length:36 Identity:11/36 - (30%)
Similarity:19/36 - (52%) Gaps:3/36 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 QRIIGGQAA--EDGFAPYQISLQGISGAHS-CGGAI 68
            ::::.|:.:  |.||....|..:.:||..| .||.|
 Frog   404 RKLLEGEESRLESGFQNLSIQTKTVSGVSSGYGGGI 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 11/35 (31%)
Tryp_SPc 38..258 CDD:238113 11/34 (32%)
krt8.1NP_001002797.1 Keratin_2_head <63..99 CDD:374433
Filament 102..413 CDD:365827 1/8 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.