DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG10232

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster


Alignment Length:287 Identity:72/287 - (25%)
Similarity:106/287 - (36%) Gaps:105/287 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISL----QGISG-AHSCGGAIINETFVLTAAHCV--------------- 81
            |:..|.||.....|:...|    :.:|. .::|.|::||:.:||||||||               
  Fly   256 RMAYGTAARPNEYPWMAMLIYENRRLSTMTNNCSGSLINKRYVLTAAHCVVKDKMVNTDLVLRRV 320

  Fly    82 ----------------ENAFIPWLVVVTGTNKYNQPGGRYFLKAIHIHCNYDN-PEMHNDIALLE 129
                            .|...|::.:          |..||    ::|..|.| ....:||||:.
  Fly   321 RLGEHDITTNPDCDFTGNCAAPFVEI----------GIEYF----NVHEQYFNTSRFESDIALVR 371

  Fly   130 LVEPIAWDERTQPI-----PLPL--VPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHREC 187
            |..|:.:.....||     |:||  .|:|      :.|||                  |..:||.
  Fly   372 LQTPVRYTHEILPICVPKDPIPLHNHPLQ------IAGWG------------------YTKNREY 412

  Fly   188 KALL------SNDEDC--------DVGHICTFSRLGEGACHGDSGGPL---VSNG-----YLVGL 230
            ..:|      .|...|        :...||.....||.:|.|||||||   ::|.     ||.|:
  Fly   413 SQVLLHNTVYENRYYCQDKISFFRNESQICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGI 477

  Fly   231 VNWGWP-CATGVPDVHASVYFYRDWIR 256
            |::|.. |....|.|:.....:..||:
  Fly   478 VSYGSENCGDRKPGVYTKTGAFFSWIK 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 70/284 (25%)
Tryp_SPc 38..258 CDD:238113 71/286 (25%)
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 71/283 (25%)
Tryp_SPc 260..503 CDD:214473 69/280 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.