DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and SPE

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster


Alignment Length:277 Identity:74/277 - (26%)
Similarity:115/277 - (41%) Gaps:45/277 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 IKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQ-----GISGAHSCGGAIINETFVLTAAHCVE 82
            :.||...|..:.| ||.||........|:.:.||     ..:...:||||::|..:||||.||:.
  Fly   121 LPGNDVCGFLFAD-RIFGGTNTTLWEFPWMVLLQYKKLFSETYTFNCGGALLNSRYVLTAGHCLA 184

  Fly    83 NAFIPWLVVV------------TGTNKYNQPGGRYFLKAIHIHCNYDNPEMH-----------ND 124
            :..:.....|            |..:...|..|:......||....:...:|           ||
  Fly   185 SRELDKSGAVLHSVRLGEWDTRTDPDCTTQMNGQRICAPKHIDIEVEKGIIHEMYAPNSVDQRND 249

  Fly   125 IALLELVEPIAWDERTQPIPLPLVPMQPGDEV----ILTGWGSTVLWGTSPIDLQVLYLQYVPHR 185
            |||:.|...:::.:..:||.||...:...:.|    .:.|||.|.....|.|.|::. :......
  Fly   250 IALVRLKRIVSYTDYVRPICLPTDGLVQNNFVDYGMDVAGWGLTENMQPSAIKLKIT-VNVWNLT 313

  Fly   186 ECKALLSNDE-DCDVGHICTFSRLGEGACHGDSGGPL---VSNG-----YLVGLVNWGW-PCA-T 239
            .|:...|:.: ..|...:|...:||...|.|||||||   :|.|     |:.|:.::|. ||. .
  Fly   314 SCQEKYSSFKVKLDDSQMCAGGQLGVDTCGGDSGGPLMVPISTGGRDVFYIAGVTSYGTKPCGLK 378

  Fly   240 GVPDVHASVYFYRDWIR 256
            |.|.|:.....:.|||:
  Fly   379 GWPGVYTRTGAFIDWIK 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 68/260 (26%)
Tryp_SPc 38..258 CDD:238113 69/262 (26%)
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 69/262 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.