DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG31199

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:320 Identity:70/320 - (21%)
Similarity:117/320 - (36%) Gaps:99/320 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VLLILLGLSGLVSITAIRIKGNSTDGRFYKDQ------------------RIIGGQAAEDGFAPY 51
            |||:|:||.| ..:.:.::..:.. |.|.:||                  ||:.|:    ||   
  Fly     7 VLLLLVGLFG-PEVRSAKVNDDQC-GAFDEDQMLNMQSTFAIPTEHQWVARIVYGK----GF--- 62

  Fly    52 QISLQGISGAHSCGGAIINETFVLTAAHC----------------VENAFIPWLVVVTGTNKY-N 99
                :|....:.|.|.::::..||..|||                |.|...|..|.|..|:.| .
  Fly    63 ----EGKIRDNGCLGVLVSKRTVLAPAHCFVQYNGVAEAFSVHLGVHNKSAPVGVRVCETDGYCV 123

  Fly   100 QPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPG----------- 153
            :|.....|..|.||.:||:..:.|.:|:|.|..    |.:..|..:|:....|.           
  Fly   124 RPSQEIKLAEIAIHPDYDSRTLKNSLAVLTLQR----DAKIYPNVMPICMPPPSLLNETLVAQTF 184

  Fly   154 --------DEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICTFSR--- 207
                    ::..|..|.:|:..|         :.|    .:.|.|:::...     :|.:.:   
  Fly   185 VVAGLRVFEDFRLKTWVNTLSRG---------FCQ----SKVKTLVTSSNT-----VCGYHKQPV 231

  Fly   208 ---LGEGACHGDSGGPLVSNGYLVG-LVNWGWPCATGVPDVHASVYFYRDWIRNVMSGNS 263
               ||.........|.:..|.|||| :::|.|. ...:.....::..|.|:||  .:.||
  Fly   232 AYYLGAPLVGLQKKGHVTQNYYLVGIMIDWRWE-NNRIMSSFLAIRNYMDFIR--QNSNS 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 55/260 (21%)
Tryp_SPc 38..258 CDD:238113 56/262 (21%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 50/244 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.