DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG7432

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_650825.2 Gene:CG7432 / 42347 FlyBaseID:FBgn0038727 Length:721 Species:Drosophila melanogaster


Alignment Length:258 Identity:76/258 - (29%)
Similarity:115/258 - (44%) Gaps:43/258 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 YKDQRIIGGQAAEDGFAPYQ--ISLQGISGAHS-CGGAIINETFVLTAAHCVENA----FIPWLV 90
            |...||:||..|.:|..|:.  |.|.|...... |||::|...::||||||..::    |.....
  Fly   470 YSTGRIVGGVEAPNGQWPWMAAIFLHGPKRTEFWCGGSLIGTKYILTAAHCTRDSRQKPFAARQF 534

  Fly    91 VV------TGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLP--- 146
            .|      ..|:........:.:|.:..|..:.....:||||:|.|.:|:...:...|:.||   
  Fly   535 TVRLGDIDLSTDAEPSDPVTFAVKEVRTHERFSRIGFYNDIAILVLDKPVRKSKYVIPVCLPKGI 599

  Fly   147 -LVPMQ--PGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGH------- 201
             :.|.:  ||....:.|||:|...|.          :....|:.:..:..:||||..:       
  Fly   600 RMPPKERLPGRRATVVGWGTTYYGGK----------ESTSQRQAELPIWRNEDCDRSYFQPINEN 654

  Fly   202 -ICT-FSRLGEGACHGDSGGPLV----SNGYLVGLVNWGWPCA-TGVPDVHASVYFYRDWIRN 257
             ||. :|..|..||.|||||||:    |:...:|:|::|..|. .|.|.|:..|..|.||||:
  Fly   655 FICAGYSDGGVDACQGDSGGPLMMRYDSHWVQLGVVSFGNKCGEPGYPGVYTRVTEYLDWIRD 717

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 72/250 (29%)
Tryp_SPc 38..258 CDD:238113 74/253 (29%)
CG7432NP_650825.2 CLIP 335..378 CDD:197829
Tryp_SPc 474..715 CDD:214473 72/250 (29%)
Tryp_SPc 475..718 CDD:238113 74/253 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.