DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG31266

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:277 Identity:112/277 - (40%)
Similarity:153/277 - (55%) Gaps:19/277 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLILLGLSGLV---SITAIRIKGNSTDG----------RFYKDQRIIGGQAAEDGFAPYQISLQG 57
            |.:||||:.|.   ...|:|::|....|          ......|:|||..|.:|..|:..|:|.
  Fly     7 LTVLLGLTLLALQGPTEAMRMRGEPLPGLANIERHRSTEAVPQGRVIGGTTAAEGNWPWIASIQN 71

  Fly    58 ISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGT-NKYNQPGGRYFLKAIHIHCNYDNPEM 121
            ....|.||..|::||:|||||.||.......|:||||| :.::.....|.:..||:|||:|.|..
  Fly    72 AYSYHLCGAIILDETWVLTAASCVAGLRPLNLLVVTGTVDWWDLYAPYYTVSQIHVHCNFDKPLY 136

  Fly   122 HNDIALLELVEPIAWDERTQPIPL-PLVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHR 185
            |||||||:|...|.:::.|:.|.| .:..::.||::...||||:...||....||.....|:|..
  Fly   137 HNDIALLQLSSKIEFNDVTKNITLADIDELEEGDKLTFAGWGSSEAMGTYGRYLQEASGTYLPVD 201

  Fly   186 ECKALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSNGY-LVGLVNWGWPCATGVPDVHASVY 249
            .|:..|.|.:|.|:||:|.....|:||||||:||||:.... |||:.|||.||..|.|||:|...
  Fly   202 ACREKLQNQDDVDLGHVCVQMDAGQGACHGDTGGPLIDEQQRLVGIGNWGVPCGRGYPDVYARTA 266

  Fly   250 FYRDWIRNVMSGNSKCT 266
            ||.||||..|:|   ||
  Fly   267 FYHDWIRTTMNG---CT 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 95/220 (43%)
Tryp_SPc 38..258 CDD:238113 97/222 (44%)
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 95/220 (43%)
Tryp_SPc 52..275 CDD:238113 97/222 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D104368at6960
OrthoFinder 1 1.000 - - FOG0007620
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.