DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG17477

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster


Alignment Length:231 Identity:111/231 - (48%)
Similarity:154/231 - (66%) Gaps:3/231 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPG 102
            |:|||.|.:|.||||:|||.:.|:|.||||||::.:::||.|||:......|.|.|||.:|.:||
  Fly    27 IVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCVKGYPTSRLQVATGTIRYAEPG 91

  Fly   103 GRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPG-DEVILTGWGSTVL 166
            ..|:..||::|||||:|:..|||.||.|.|.|.::..||.:.||..|...| .|::.|||||...
  Fly    92 AVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPTSPFPRGASELVFTGWGSQSA 156

  Fly   167 WGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVG--HICTFSRLGEGACHGDSGGPLVSNGYLVG 229
            .|:.|..||.:..|::....|::::|..||.::|  |||.:.:...||||||||||||..|.|||
  Fly   157 AGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANIGACHGDSGGPLVHQGTLVG 221

  Fly   230 LVNWGWPCATGVPDVHASVYFYRDWIRNVMSGNSKC 265
            ::|:..|||.||||:..::.:||||:|..||||.||
  Fly   222 ILNFFVPCAQGVPDIFMNIMYYRDWMRQTMSGNGKC 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 103/219 (47%)
Tryp_SPc 38..258 CDD:238113 105/222 (47%)
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 105/222 (47%)
Tryp_SPc 27..246 CDD:214473 102/218 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449452
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D104368at6960
OrthoFinder 1 1.000 - - FOG0007620
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.