DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG10405

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster


Alignment Length:299 Identity:88/299 - (29%)
Similarity:133/299 - (44%) Gaps:89/299 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VVLLILLGLSGLVSITAIRIKGNSTDGRFYK--DQRIIGGQAAEDGFAPYQISLQGISGAHSCGG 66
            :..|::.|:  ||.:.|.|     |:....:  |.||:.|:.|.:|..|||:||:. ...|.||.
  Fly     8 IPFLLIAGI--LVILEASR-----TEAAVPRQPDSRIVNGREATEGQFPYQLSLRR-QTVHICGA 64

  Fly    67 AIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQP--------------GGRYF-LKAIHIHCNY 116
            :|::..:.:|||||::             ....||              ||... :|||:.|..|
  Fly    65 SILSSNWAITAAHCID-------------GHEQQPREFTLRQGSIMRTSGGTVQPVKAIYKHPAY 116

  Fly   117 DNPEMHNDIALLELVE-----PIAWDERTQPIPLPLVPMQPGDEV------ILTGWG--STVLWG 168
            |..:|:.|:|||...:     |:.   :..||.||.|    |:.:      :::|||  ||    
  Fly   117 DRADMNFDVALLRTADGALSLPLG---KVAPIRLPTV----GEAISESMPAVVSGWGHMST---- 170

  Fly   169 TSPIDLQVLYLQYVPHRECKALLSNDEDC--DVGH--------ICTFSRLGEGACHGDSGGPLVS 223
            ::|:...||       :....|..|.|.|  |:.|        .|..:| ...||.||||||:.:
  Fly   171 SNPVLSSVL-------KSTTVLTVNQEKCHNDLRHHGGVTEAMFCAAAR-NTDACQGDSGGPISA 227

  Fly   224 NGYLVGLVNWGWPCATG-VPDV-----HASVYFYRDWIR 256
            .|.|:|:|:||..||.. .|.|     |.::   |.|||
  Fly   228 QGTLIGIVSWGVGCADPYYPGVYTRLAHPTI---RRWIR 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 77/261 (30%)
Tryp_SPc 38..258 CDD:238113 79/263 (30%)
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 77/261 (30%)
Tryp_SPc 37..263 CDD:238113 77/261 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.