DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and ea

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster


Alignment Length:288 Identity:81/288 - (28%)
Similarity:122/288 - (42%) Gaps:71/288 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GNSTDGRFYKDQRIIGGQAAEDGFAPYQISL-----QGISGAHSCGGAIINETFVLTAAHCVENA 84
            ||....|.|      ||...:....|:...:     ||..| |.|||::|:..:|:||:|||...
  Fly   121 GNILSNRIY------GGMKTKIDEFPWMALIEYTKSQGKKG-HHCGGSLISTRYVITASHCVNGK 178

  Fly    85 FIP------------WLVVVTGTNKYNQPGGRYFLKAI------HIHCNYDNPEMH--------- 122
            .:|            |   .|.||    |.....::.:      |:....:....|         
  Fly   179 ALPTDWRLSGVRLGEW---DTNTN----PDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIPASKN 236

  Fly   123 --NDIALLELVEPIAWDERTQPIPLPL-VPMQ----PGDEVILTGWGSTVLWGTSPIDLQVLYLQ 180
              ||||||.|.:.:.:.:..:||.||| |.::    .|..:.:.|||.|.....|.:.|:.. ::
  Fly   237 QVNDIALLRLAQQVEYTDFVRPICLPLDVNLRSATFDGITMDVAGWGKTEQLSASNLKLKAA-VE 300

  Fly   181 YVPHRECKALLSND----EDCDVGHICTFSRLGEGACHGDSGGPLVS------NGY--LVGLVNW 233
            .....||:.:.|:.    ||.   .:|...:.|..:|.|||||||:.      |.|  |.|:|::
  Fly   301 GFRMDECQNVYSSQDILLEDT---QMCAGGKEGVDSCRGDSGGPLIGLDTNKVNTYYFLAGVVSF 362

  Fly   234 G-WPCA-TGVPDVHASVYFYRDWIRNVM 259
            | .||. .|.|.|:..|..|.|||:|.:
  Fly   363 GPTPCGLAGWPGVYTLVGKYVDWIQNTI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 74/270 (27%)
Tryp_SPc 38..258 CDD:238113 76/272 (28%)
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 76/276 (28%)
Tryp_SPc 128..389 CDD:238113 77/278 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.