DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG8870

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:231 Identity:63/231 - (27%)
Similarity:97/231 - (41%) Gaps:45/231 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 CGGAIINETFVLTAAHCVENAFI--PWLVVVTGTNKYNQP--------GGRYFLKAIHIHCNYDN 118
            |||::||..:|||||||||..|:  |:.:......::|..        .||.....:::....|.
  Fly   117 CGGSLINNWYVLTAAHCVEYPFMDYPYALKTVRLGEHNTSTNPDRAIVNGRRQYAPLYMEIEVDQ 181

  Fly   119 PEMH----------NDIALLELVEPIAWDERTQPIPLPLVPMQPGD--EVILTGWGSTVLWGTSP 171
            ...|          |||||:.|..|:.:....|||.||........  :...:||...    ...
  Fly   182 IITHEQFNRGRRLINDIALVRLKFPVRYTRAIQPICLPRAQKLAAHKRKFQASGWPDM----GQG 242

  Fly   172 IDLQVLYLQYVPHRE---CKALLSNDEDCDVG-HICTFSRLGEGACHGDSGGPL--------VSN 224
            |..:||...::..|.   ||    ::.|.::| .||.....|.....|||||||        |:.
  Fly   243 IASEVLLRSFIAERHPDVCK----SNYDFNLGSQICAGGLDGNDTSPGDSGGPLMETVIRGKVTL 303

  Fly   225 GYLVGLVNWGW-PCA--TGVPDVHASVYFYRDWIRN 257
            .|..|::::|. ||.  |..|..:....::.:||::
  Fly   304 TYAAGIISYGQKPCVLKTCKPAFYTKTSYFFEWIKS 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 61/227 (27%)
Tryp_SPc 38..258 CDD:238113 63/231 (27%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 63/231 (27%)
Tryp_SPc 93..337 CDD:214473 61/227 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.