DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG11670

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001368950.1 Gene:CG11670 / 41608 FlyBaseID:FBgn0038114 Length:431 Species:Drosophila melanogaster


Alignment Length:230 Identity:72/230 - (31%)
Similarity:102/230 - (44%) Gaps:33/230 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 HSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNK-----YNQPGGRYFLKAIHIHCNYDNPEM 121
            :.|||::|:|.||||||||:........:|..|..|     .|....|..:..|::|..|:....
  Fly   198 YKCGGSLISEEFVLTAAHCLTTHGTSPDIVKIGDIKLKEWELNVAPQRRRVAQIYLHPLYNASLN 262

  Fly   122 HNDIALLELVEPI--AWDERTQPIPLPLVPMQ--PGDEVILTGWGSTVLWGTSPIDLQVLYLQYV 182
            ::||.|::|..|:  .|..|    |:.|.||.  |..::...|:|||.........|..|.|..|
  Fly   263 YHDIGLIQLNRPVEYTWFVR----PVRLWPMNDIPYGKLHTMGYGSTGFAQPQTNILTELDLSVV 323

  Fly   183 PHRECKALLSNDEDCDVG----HICTFS-RLGEGACHGDSGGPLVSN---------------GYL 227
            |..:|.:.|..||....|    .||... ......|.|||||||..|               .||
  Fly   324 PIEQCNSSLPADEGSPHGLLTSQICAHDYEKNRDTCQGDSGGPLQLNLERRRRRHTSRKHYRYYL 388

  Fly   228 VGLVNWGWPCATGVPDVHASVYFYRDWIRNVMSGN 262
            ||:.::|..|.:.:|.|:..|..|.|||.:::..|
  Fly   389 VGITSYGAYCRSELPGVYTRVSSYIDWIASIVWPN 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 69/221 (31%)
Tryp_SPc 38..258 CDD:238113 71/224 (32%)
CG11670NP_001368950.1 Tryp_SPc 172..419 CDD:238113 71/224 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.