DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and snk

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster


Alignment Length:263 Identity:75/263 - (28%)
Similarity:117/263 - (44%) Gaps:32/263 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TD-GRFYKDQR-------IIGGQAAEDGFAPYQISLQGISGAHS--------CGGAIINETFVLT 76
            || ||.:..::       |:||.....|..|:..:|....|:.|        ||||:::|.:|||
  Fly   168 TDTGRTFSGKQCVPSVPLIVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLT 232

  Fly    77 AAHCVENAFIPWLVVVTGTNKYNQPGGR---YFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDE 138
            ||||..:...|..:|..|..:.|:....   ..:..|.:|..|.:...::|||||:|...:.:.|
  Fly   233 AAHCATSGSKPPDMVRLGARQLNETSATQQDIKILIIVLHPKYRSSAYYHDIALLKLTRRVKFSE 297

  Fly   139 RTQPIPLPLVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCD----V 199
            :.:|..|..:|......|:..|||.|...|.....|:.:.|..||...||.:...:....    .
  Fly   298 QVRPACLWQLPELQIPTVVAAGWGRTEFLGAKSNALRQVDLDVVPQMTCKQIYRKERRLPRGIIE 362

  Fly   200 GHICT-FSRLGEGACHGDSGGPLVS-------NGYLVGLVNWGWPCAT-GVPDVHASVYFYRDWI 255
            |..|. :...|...|.||||||:.:       ..::||:.::|..||. ..|.|:..:|.|.|||
  Fly   363 GQFCAGYLPGGRDTCQGDSGGPIHALLPEYNCVAFVVGITSFGKFCAAPNAPGVYTRLYSYLDWI 427

  Fly   256 RNV 258
            ..:
  Fly   428 EKI 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 69/248 (28%)
Tryp_SPc 38..258 CDD:238113 71/243 (29%)
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 71/243 (29%)
Tryp_SPc 186..427 CDD:214473 69/240 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.