DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG3916

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_650167.1 Gene:CG3916 / 41484 FlyBaseID:FBgn0038003 Length:267 Species:Drosophila melanogaster


Alignment Length:277 Identity:93/277 - (33%)
Similarity:137/277 - (49%) Gaps:43/277 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQ----GISGAHSC 64
            ::|::..||:.:|:.|.            ....||.|||...: ..|:|:|||    | ...|.|
  Fly     9 MLLILRQGLADVVTSTT------------ESPTRINGGQRVNE-TVPFQVSLQMQRRG-RWQHFC 59

  Fly    65 GGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFLKAIHIHCNYD-NPEMHNDIALL 128
            ||:|::...|||||||:|...:..:.||.||..:...|.|:.|...|:|..|. ||.:.|||||:
  Fly    60 GGSIVSGQHVLTAAHCMEKMKVEDVSVVVGTLNWKAGGLRHRLVTKHVHPQYSMNPRIINDIALV 124

  Fly   129 ELVEPIAWDERTQPIPLPLVPMQPGDE------VILTGWGST---VLWGTSPIDLQVLYLQYVPH 184
            ::..|.    |.:...:..:.:...|.      |.|||||||   ....|.|..||.|..:.:.:
  Fly   125 KVTPPF----RLERSDISTILIGGSDRIGEKVPVRLTGWGSTSPSTSSATLPDQLQALNYRTISN 185

  Fly   185 RECKALLSNDEDCDV--GHICTFSRLGEGACHGDSGGPLVSNG---YLVGLVNWG-WPCATGVPD 243
            .:|     |.:...|  ..||..:..|:|||.|||||||:..|   :|||:|::| ..||.|.||
  Fly   186 EDC-----NQKGFRVTRNEICALAVQGQGACVGDSGGPLIRPGKQPHLVGIVSYGSSTCAQGRPD 245

  Fly   244 VHASVYFYRDWIRNVMS 260
            |:..|..:..:|..|::
  Fly   246 VYTRVSSFLPYISQVIN 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 86/237 (36%)
Tryp_SPc 38..258 CDD:238113 86/239 (36%)
CG3916NP_650167.1 Tryp_SPc 30..257 CDD:214473 86/237 (36%)
Tryp_SPc 31..260 CDD:238113 86/239 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449468
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.