DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG12951

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:259 Identity:88/259 - (33%)
Similarity:126/259 - (48%) Gaps:17/259 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFV 74
            |.|| |:.|.|:...|.:..    ...|::.|..:.....|:.:||:...|:|||||:||::.||
  Fly     7 LSLS-LIVILAVTTVGQAAP----SISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFV 66

  Fly    75 LTAAHCVENAFIPWLVVVTGTNKYNQPGGRYF-LKAIHIHCNYDNPEMH-NDIALLELVEPIAWD 137
            :|||||........|.:..|....:..|.... :|.|..|.::|....: |||:||.:.||..:|
  Fly    67 MTAAHCTNGRPADTLSIQFGVTNISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFD 131

  Fly   138 -ERTQPIPLP----LVPM-QPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDED 196
             ....|:.||    .||. ..|.|.:|.|||....:|:....||.:.|:.....||.:..:...|
  Fly   132 GVSVAPVELPALAFAVPQSDAGVEGVLIGWGLNDTYGSVQDTLQEVSLKIYSDEECTSRHNGQTD 196

  Fly   197 CDVGHIC-TFSRLGEGACHGDSGGPLVSNGYLVGLVNWG-WPCATG-VPDVHASVYFYRDWIRN 257
            ... ||| .....|:|.|.|||||||:.||..||:|:|. .||... .|.|:..|..|.|||::
  Fly   197 PKY-HICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKS 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 79/228 (35%)
Tryp_SPc 38..258 CDD:238113 80/231 (35%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 79/228 (35%)
Tryp_SPc 30..260 CDD:238113 80/231 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7840
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.