DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG13318

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:241 Identity:74/241 - (30%)
Similarity:115/241 - (47%) Gaps:24/241 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTG-----TNKYNQ 100
            |||: .|..|:|.:|...:..:..|||:|....||||||.|.|..:.:..|..|     :.....
  Fly   167 GQAS-FGAYPWQAALLTTADVYLGGGALITAQHVLTAAHKVYNLGLTYFKVRLGEWDAASTSEPI 230

  Fly   101 PGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQ--PIPLPLVPMQPGDEVILTGWGS 163
            |....::..::::.:::...:.||:|:|:|..|::...::.  .:.||.... .|....:.|||.
  Fly   231 PAQDVYISNVYVNPSFNPNNLQNDVAILKLSTPVSLTSKSTVGTVCLPTTSF-VGQRCWVAGWGK 294

  Fly   164 TVLWGT---SPIDLQVLYLQYVPHRECKALL------SNDEDCDVGHICTFSRLGEGACHGDSGG 219
            .....|   ..|:.|| .:..:|:..|:|.|      |:........||.....|:.||.||.|.
  Fly   295 NDFGATGAYQAIERQV-DVPLIPNANCQAALQATRLGSSFVLSPTSFICAGGEAGKDACTGDGGS 358

  Fly   220 PLV--SNG--YLVGLVNWGWPCA-TGVPDVHASVYFYRDWIRNVMS 260
            |||  |||  |:||||.||..|| .|||.|:.:|..|..||:..::
  Fly   359 PLVCTSNGVWYVVGLVAWGIGCAQAGVPGVYVNVGTYLPWIQTTLT 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 72/234 (31%)
Tryp_SPc 38..258 CDD:238113 74/237 (31%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 72/235 (31%)
Tryp_SPc 169..399 CDD:214473 70/232 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.