DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Klk4

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001004101.1 Gene:Klk4 / 408210 RGDID:1303228 Length:256 Species:Rattus norvegicus


Alignment Length:247 Identity:73/247 - (29%)
Similarity:116/247 - (46%) Gaps:27/247 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 IRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAF 85
            :.:.|:|...   ...|||.||.......|:|.:|.....|..|.|.:::..:||:||||:::::
  Rat    18 LEVTGSSASS---ISSRIIQGQDCLPHSQPWQAALFSEDNAFFCSGVLVHPQWVLSAAHCIQDSY 79

  Fly    86 IPWLVVVTGTNKYN-----QPGGRYFLKAIHI-HCNYDNPEMHNDIALLELVEPIAWDERTQPIP 144
                  ..|...:|     :||.|.....:.| |.||::|...||:.|::|.|.:......:.||
  Rat    80 ------TVGLGLHNLEGSQEPGSRMLEAHLSIQHPNYNDPSFANDLMLIKLNESVMESNTIRRIP 138

  Fly   145 LPLVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICTFSRLG 209
            :......|||..:::||| .:..|..|..||.:.|.......|:.|..     .|.|:..|...|
  Rat   139 VASQCPTPGDTCLVSGWG-RLKNGKLPSLLQCVNLSVASEETCRLLYD-----PVYHLSMFCAGG 197

  Fly   210 ----EGACHGDSGGPLVSNGYLVGLVNWG-WPCA-TGVPDVHASVYFYRDWI 255
                :..|:||||||:|.|..|.|||:.| ..|. .|:|.|:.::..:.:||
  Rat   198 GPDRKDTCNGDSGGPIVCNRSLQGLVSMGQGECGQPGIPSVYTNLCKFTNWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 69/229 (30%)
Tryp_SPc 38..258 CDD:238113 70/230 (30%)
Klk4NP_001004101.1 Tryp_SPc 35..249 CDD:238113 66/225 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341305
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.