DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Tryx5

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_006236430.1 Gene:Tryx5 / 408205 RGDID:1302947 Length:251 Species:Rattus norvegicus


Alignment Length:281 Identity:65/281 - (23%)
Similarity:111/281 - (39%) Gaps:55/281 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCG 65
            |...::..||.|: :.|...:.:||:.....:          ..|:...||...|:  |....|.
  Rat     1 MKTFIIFALLSLA-VASYPEVVLKGDQDSDEY----------LPENFNVPYMAYLK--SSPEPCV 52

  Fly    66 GAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFLKAIH------IHCNYDNPEMHND 124
            |.:|:..:|||||||    .:|..:.: |..:.|....:   :.||      :|.|:|.....||
  Rat    53 GTLIDPLWVLTAAHC----SLPTKIRL-GVYRPNIKNEK---EQIHGYSLTVVHPNFDANIRKND 109

  Fly   125 IALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGW----------GSTVLW----GTSPIDL- 174
            :.|::|..|...|.....|.:.:.||...:...:..|          ..|:.|    ..||.|. 
  Rat   110 LMLIKLSYPATIDMYVGTIAIAMEPMVFNETCFIPTWTWNHYNNYSDPDTLTWTNQYSRSPSDCW 174

  Fly   175 QVLYLQYVPHRECKALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWGWPCAT 239
            ..|:.|   .:|.:..:.    | :||  :|:  .:.:....|..|.:.:|.:.|:::||....|
  Rat   175 NTLHQQ---RQETRINIM----C-IGH--SFN--VKSSTKEVSAAPAICSGRVHGILSWGKAGIT 227

  Fly   240 -GVPDVHASVYFYRDWIRNVM 259
             |.......::.|..||..||
  Rat   228 NGSEGFFTEIHPYARWILRVM 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 54/239 (23%)
Tryp_SPc 38..258 CDD:238113 56/241 (23%)
Tryx5XP_006236430.1 Tryp_SPc 37..244 CDD:419748 53/228 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341300
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.