DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and prss29

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001001228.1 Gene:prss29 / 407909 XenbaseID:XB-GENE-6453402 Length:330 Species:Xenopus tropicalis


Alignment Length:266 Identity:89/266 - (33%)
Similarity:130/266 - (48%) Gaps:50/266 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 QRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQ 100
            :||:||..:|:|..|:||||: ..|...|||:::.:::|||||||.::         ...:||..
 Frog    24 KRIVGGTDSEEGEWPWQISLE-FEGGFLCGGSLLTDSWVLTAAHCFDS---------MNVSKYTA 78

  Fly   101 PGGRYFL-----------KAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPL--VPMQP 152
            ..|.|.|           |.|.:|.:|.......||||:||.|||.:....||:.||.  ||:..
 Frog    79 YLGVYQLSDLDNAVLRGVKNITVHPDYMYEGSSGDIALIELEEPIVFTPSIQPVCLPSQDVPLPM 143

  Fly   153 GDEVILTGWG----STVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGH-----------I 202
            |....:||||    :|.|  ..|..||...:..:....|:|:..:    .:|:           |
 Frog   144 GTMCWVTGWGNIKENTPL--EDPQTLQKAEVGLINRTSCEAMYQS----SLGYRPSIHLIQDDMI 202

  Fly   203 CTFSRLGE-GACHGDSGGPLV---SNGYL-VGLVNWGWPCA-TGVPDVHASVYFYRDWIRNVMSG 261
            |...:.|: .||.||||||||   ||.:| .|:|:||..|| ...|.|:.:|.:|..||:.::..
 Frog   203 CAGYKQGKIDACQGDSGGPLVCNTSNTWLQFGIVSWGLGCAEPNQPGVYTNVQYYLTWIQELVPS 267

  Fly   262 NSKCTG 267
            ...|.|
 Frog   268 VMFCDG 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 85/251 (34%)
Tryp_SPc 38..258 CDD:238113 86/253 (34%)
prss29NP_001001228.1 Tryp_SPc 26..263 CDD:238113 86/252 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.