DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and MP1

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:261 Identity:79/261 - (30%)
Similarity:114/261 - (43%) Gaps:41/261 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQ----GISGAHSCGGAIINETFVLTAAHCVENAFIPW--------- 88
            |::||........|:...::    |....|.|||::||..:||||||||......|         
  Fly   137 RVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSAIPSDWELTGVRLGE 201

  Fly    89 ---------LVVVTGTNKYNQPGGRYFLKAIHIHCNY--DNPEMHNDIALLELVEPIAWDERTQP 142
                     .|...|....|:|...|.::....|..|  ::.:..||||||.|.:.:.:.:...|
  Fly   202 WDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALLRLRDEVQYSDFILP 266

  Fly   143 IPLPLVPMQP-----GDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHREC-KALLSNDEDCDVGH 201
            :.||.:..|.     |.:|::.|||.|....||.|.|:. .|..||..|| :...:.........
  Fly   267 VCLPTLASQHNNIFLGRKVVVAGWGRTETNFTSNIKLKA-ELDTVPTSECNQRYATQRRTVTTKQ 330

  Fly   202 ICTFSRLGEGACHGDSGGPLV--------SNGYLVGLVNWG-WPCA-TGVPDVHASVYFYRDWIR 256
            :|.....|..:|.|||||||:        ||.|:.|:|::| .||. .|.|.|:..|..|.:||.
  Fly   331 MCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYGPTPCGLKGWPGVYTRVEAYLNWIE 395

  Fly   257 N 257
            |
  Fly   396 N 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 76/257 (30%)
Tryp_SPc 38..258 CDD:238113 78/260 (30%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 76/257 (30%)
Tryp_SPc 138..397 CDD:238113 78/260 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.