DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG18223

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster


Alignment Length:260 Identity:70/260 - (26%)
Similarity:118/260 - (45%) Gaps:50/260 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 FYKDQRIIGGQAAEDGFAPYQISLQG------ISGAHSCGGAIINETFVLTAAHC-------VEN 83
            |.|::.::        .|.|.:|::.      ....|.|||.||:.|::||:|||       |..
  Fly    49 FDKEKTLV--------LAKYVVSIRSRRPHKLFGDNHFCGGVIISRTYILTSAHCAMDKRKIVHR 105

  Fly    84 AFIPWLVVVTG-TNKYNQPGG---RYFLKAIHIHCNYDNPEMH-----NDIALLELVEPIAWDER 139
            :.:  ||||.| ||:.....|   ...:|.|.:      |:..     |:|||:.|.:.:..|  
  Fly   106 SRV--LVVVAGTTNRLKSRKGLSLNMEVKKIFV------PDKFTVFNTNNIALMMLAKKLPLD-- 160

  Fly   140 TQP----IPLPLVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHREC--KALLSNDEDCD 198
             .|    |.||....:||....:.|||.....|....|:..:.::.:|...|  |..:..:|...
  Fly   161 -NPLVGVINLPTADPEPGLNYTVLGWGRIFKGGPLASDILHIDVELLPRDICEKKVHIFKEEMMC 224

  Fly   199 VGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWGWPCAT-GVPDVHASVYFYRDWIRNVMSGN 262
            .|::  .:.:.|..|.||:|.||:.|..:.|:|::...|.: .:|.::.:||.:.|||..:|:.|
  Fly   225 AGNL--NNTMDENPCAGDTGSPLIFNETVFGVVSYRVGCGSKTLPSIYTNVYMHMDWINGIMNNN 287

  Fly   263  262
              Fly   288  287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 64/246 (26%)
Tryp_SPc 38..258 CDD:238113 66/248 (27%)
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 65/235 (28%)
Tryp_SPc 60..280 CDD:214473 63/232 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.