DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG4998

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001036609.1 Gene:CG4998 / 39808 FlyBaseID:FBgn0036612 Length:1185 Species:Drosophila melanogaster


Alignment Length:279 Identity:72/279 - (25%)
Similarity:121/279 - (43%) Gaps:57/279 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISL---QGISGAHSCGGAIINET 72
            |::|.:. ..:.:.|:|..|.:                 |:.:::   ......::|||.:|:..
  Fly   928 GITGRIK-NPVYVDGDSEFGEY-----------------PWHVAILKKDPKESIYACGGTLIDAQ 974

  Fly    73 FVLTAAHCV--ENAFIPWLVVVTGTNKYNQ-----PGGRYFLKAIHIHCNYDNPEMHNDIALLEL 130
            .:::||||:  :|.|.  |.|..|....|.     |.....:.::|||..|....:.||:|:|:|
  Fly   975 HIISAAHCIKSQNGFD--LRVRLGEWDVNHDVEFFPYIERDVVSVHIHPEYYAGTLDNDLAVLKL 1037

  Fly   131 VEPIAWDERTQPIPLPLVPMQ---PGDEVILTGWGSTVLWG--------TSPIDLQVLYLQYVPH 184
            .:|:.:.:.....|..|....   .|.....||||... :|        ...:|:.:|     .|
  Fly  1038 DQPVDFTKNPHISPACLPDKYSDFTGARCWTTGWGKDA-FGEHGKYQNILKEVDVPIL-----SH 1096

  Fly   185 RECKALLSNDE-----DCDVGHICTFSRLGEGACHGDSGGPLV--SNG--YLVGLVNWGWPCA-T 239
            ::|::.|.|..     ..:.|.:|.....|:.||.||.|||||  .||  ::||:|:||..|. .
  Fly  1097 QQCESQLRNTRLGYSYKLNPGFVCAGGEEGKDACKGDGGGPLVCDRNGAMHVVGVVSWGIGCGQV 1161

  Fly   240 GVPDVHASVYFYRDWIRNV 258
            .||.|:..|..|..||:.:
  Fly  1162 NVPGVYVKVSAYLPWIQQI 1180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 65/248 (26%)
Tryp_SPc 38..258 CDD:238113 67/250 (27%)
CG4998NP_001036609.1 Tryp_SPc 942..1180 CDD:238113 69/262 (26%)
Tryp_SPc 942..1177 CDD:214473 67/259 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.