DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG4613

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster


Alignment Length:244 Identity:75/244 - (30%)
Similarity:113/244 - (46%) Gaps:42/244 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAH-SCGGAIINETFVLTAAHCVENAFIPWLVV--------- 91
            ||:||........|:  ..|.|.|.. .|||.:||:.:||||||||....:..:.|         
  Fly   136 RIVGGTQVRTNKYPW--IAQIIRGTFLFCGGTLINDRYVLTAAHCVHGMDMRGVSVRLLQLDRSS 198

  Fly    92 ----VTGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQP 152
                ||.:..:           .|.|..||...:.:|||||.|.:||...:..:|..||...:|.
  Fly   199 THLGVTRSVAF-----------AHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACLPSNWLQN 252

  Fly   153 GD--EVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKA-----LLSNDEDCDVGHICTFSRLGE 210
            .|  :.|:.|||.:...|::...||.:.:..:.:.:|:|     ::.:...| .|::.|.   |.
  Fly   253 FDFQKAIVAGWGLSQEGGSTSSVLQEVVVPIITNAQCRATSYRSMIVDTMMC-AGYVKTG---GR 313

  Fly   211 GACHGDSGGPLVSNG---YLVGLVNWGWPCA-TGVPDVHASVYFYRDWI 255
            .||.|||||||:...   .|.|:|::|:.|| ...|.|:..|..|.:||
  Fly   314 DACQGDSGGPLIVRDRIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 73/242 (30%)
Tryp_SPc 38..258 CDD:238113 74/243 (30%)
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 73/242 (30%)
Tryp_SPc 137..362 CDD:238113 72/241 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.