DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG10663

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster


Alignment Length:266 Identity:74/266 - (27%)
Similarity:116/266 - (43%) Gaps:63/266 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYN-Q 100
            :||||:||..|..|:|:::........|||.:|...:||||||||...    |.|..|.:..| :
  Fly   506 KIIGGRAARKGEWPWQVAILNRFKEAFCGGTLIAPRWVLTAAHCVRKV----LFVRIGEHNLNYE 566

  Fly   101 PGGRYFLKAI--HIHCNYDNPEMHNDIALLELVEPIAWDERT----QPIPLPLVPMQPGDEVILT 159
            .|....|:.:  :.|.|:|...:.:|:|||.|  |.|.:..|    ..:|.|...:....:..:.
  Fly   567 DGTEIQLRVMKSYTHPNFDKRTVDSDVALLRL--PKAVNATTWIGYSCLPQPFQALPKNVDCTII 629

  Fly   160 GWG----------STVLWGTSPIDLQVLYLQYVPHRECKAL-----LSNDEDC---DVGHICTFS 206
            |||          |.:...|.||         :|.:.|:.:     ::.:..|   ..|||.|  
  Fly   630 GWGKRRNRDATGTSVLHKATVPI---------IPMQNCRKVYYDYTITKNMFCAGHQKGHIDT-- 683

  Fly   207 RLGEGACHGDSGGPLVSNG--------YLVGLVNWGWPCAT----GVPDVHASVYFYRDWIRNVM 259
                  |.|||||||:...        .:.|:.::|..||.    |   ::|.|..|.||:.:|:
  Fly   684 ------CAGDSGGPLLCRDTTKPNHPWTIFGITSFGDGCAQRNKFG---IYAKVPNYVDWVWSVV 739

  Fly   260 SGNSKC 265
            :.:..|
  Fly   740 NCDGNC 745

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 71/254 (28%)
Tryp_SPc 38..258 CDD:238113 72/256 (28%)
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 71/254 (28%)
Tryp_SPc 507..735 CDD:238113 71/253 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.