DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG11529

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster


Alignment Length:281 Identity:82/281 - (29%)
Similarity:120/281 - (42%) Gaps:53/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LSGLVSITAIRIKGNSTD---------GRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHS---C 64
            |.||..|..:..|...||         ||..|              .|||:.|.|......   |
  Fly     9 LLGLAVIMLMMWKPTPTDSYAVGQSKYGRIEK--------------FPYQVMLIGKQLWRKRILC 59

  Fly    65 GGAIINETFVLTAAHCVENAFIPWLVVVTGTNKY--NQPGGRYFLKA--IHIHCNYDNPE-MHND 124
            ||.::::.::|||.||...  :....|..||...  .:..|...|::  ..:|..: ||| ..||
  Fly    60 GGTLLDKRWILTAGHCTMG--VTHYDVYLGTKSVEDTEVSGGLVLRSNKFIVHERF-NPETAAND 121

  Fly   125 IALLELVEPIAWDERTQPIPLP---LVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRE 186
            |||::|.:.:|:..|.||..||   ......|..|:.:|||:.|.. |:...:|...|:.:.:.|
  Fly   122 IALVKLPQDVAFTPRIQPASLPSRYRHDQFAGMSVVASGWGAMVEM-TNSDSMQYTELKVISNAE 185

  Fly   187 CKALLSNDEDCDV---GHICTFSRLGEGACHGDSGGPLV--SNGYLVGLVNWGWP---CATGVPD 243
            |.      ::.||   |.||......|..|.||||||||  ....:||:.::| |   |.|.:|.
  Fly   186 CA------QEYDVVTSGVICAKGLKDETVCTGDSGGPLVLKDTQIVVGITSFG-PADGCETNIPG 243

  Fly   244 VHASVYFYRDWIRNVMSGNSK 264
            ....|..|.|||.:.:..:.:
  Fly   244 GFTRVTHYLDWIESKIGSHGQ 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 70/236 (30%)
Tryp_SPc 38..258 CDD:238113 72/238 (30%)
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 74/245 (30%)
Tryp_SPc 37..255 CDD:214473 72/242 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.