DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and proca

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_956650.1 Gene:proca / 393327 ZFINID:ZDB-GENE-060824-5 Length:434 Species:Danio rerio


Alignment Length:246 Identity:81/246 - (32%)
Similarity:121/246 - (49%) Gaps:26/246 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPG 102
            ::||...:.|.:|:|..:....|...|||.:|:|.:|||||||:|.: ..:.|.:....::...|
Zfish   195 VMGGNVGKRGESPWQALILNHLGRFHCGGVLIDENWVLTAAHCLETS-SKFSVRLGDYQRFKFEG 258

  Fly   103 GRYFLKA-IHI-HCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPM------QPGDEVILT 159
            ....|.. .|| |..|:...:.||||||.|..|:.:.....|..||.:.:      :.|...|:|
Zfish   259 SEVTLPVKQHISHPQYNPITVDNDIALLRLDGPVKFSTYILPACLPSLELAKRMLHRNGTVTIIT 323

  Fly   160 GWGSTVLWGTS-PIDLQVLYLQYVPHREC-KALLSNDEDCDVGHICTFSRLGE--GACHGDSGGP 220
            |||......|| ...|..:.|..|.::|| :.:::|..|   ..:|. ..||:  .||.||||||
Zfish   324 GWGKNNQSATSYNSTLHYVELPIVDNKECSRHMMNNLSD---NMLCA-GVLGQVKDACEGDSGGP 384

  Fly   221 LVS----NGYLVGLVNWGWPCATGVPD---VHASVYFYRDWIRNVMSGNSK 264
            :::    ..:|||||:||..|  |..|   ::..|..|.|||.:|..|..|
Zfish   385 MMTLFHDTWFLVGLVSWGEGC--GQRDKLGIYTKVASYLDWIDSVRQGWDK 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 76/235 (32%)
Tryp_SPc 38..258 CDD:238113 78/238 (33%)
procaNP_956650.1 GLA 23..84 CDD:214503
EGF_CA 85..119 CDD:238011
FXa_inhibition 128..165 CDD:291342
Tryp_SPc 195..427 CDD:238113 78/238 (33%)
Tryp_SPc 197..424 CDD:214473 76/233 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.