DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG18179

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster


Alignment Length:282 Identity:78/282 - (27%)
Similarity:122/282 - (43%) Gaps:53/282 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LILLGLSGLVSITAIRIKGNST---------DGRFYKDQRIIGGQAAEDGFAPYQISL----QGI 58
            |.||.||..:::.|.....|.|         :|   .:.||:.|..|.:|.|||.:.|    .|.
  Fly     3 LFLLTLSVALAVVAASPGFNRTSLLPQVTISEG---AEGRIVNGYPAPEGKAPYIVGLLIRTDGS 64

  Fly    59 SGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFLKAIH-----IHCNYDN 118
            :.|....|.||...::||||||:...::.   :..|:| :...|.  |.:::.     .|.|:. 
  Fly    65 NSAAVGAGTIIASDWILTAAHCLTTDYVE---IHYGSN-WGWNGA--FRQSVRRDNFISHPNWP- 122

  Fly   119 PEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILT-----GW-----GSTVLWGTSPID 173
            .|...||.|:. ...:.:.:....:.||.. .:..|..:.|     ||     |:...|      
  Fly   123 AEGGRDIGLIR-TPSVGFTDLINKVALPSF-SEESDRFVDTWCVACGWGGMDNGNLADW------ 179

  Fly   174 LQVLYLQYVPHRECKALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVS--NGYLVGLVNWG-W 235
            ||.:.:|.:.:.||:.........|   :||....|:.:|.||||||||:  |..|||::.:| .
  Fly   180 LQCMDVQIISNSECEQSYGTVASTD---MCTRRTDGKSSCGGDSGGPLVTHDNARLVGVITFGSV 241

  Fly   236 PCATGVPDVHASVYFYRDWIRN 257
            .|.:| |..:..|..|..|||:
  Fly   242 DCHSG-PSGYTRVTDYLGWIRD 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 66/239 (28%)
Tryp_SPc 38..258 CDD:238113 68/242 (28%)
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 66/239 (28%)
Tryp_SPc 40..263 CDD:238113 68/242 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.