DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG3088

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster


Alignment Length:294 Identity:70/294 - (23%)
Similarity:108/294 - (36%) Gaps:95/294 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHS---CGG 66
            :|::.|||:   .:.|...|.:|.|    .|..|..|..|.:|.|||.:   |::...|   |.|
  Fly     3 LLVVFLGLT---LVAAGSAKKDSED----PDHIITNGSPAYEGQAPYVV---GMAFGQSNIWCSG 57

  Fly    67 AIINETFVLTAAHCVENA----------------FIPWLVVVTGTNKY---NQPGGRYFLKAIHI 112
            .||.:|::||:|.|:..:                |    .|..||::|   ||            
  Fly    58 TIIGDTWILTSAQCLTGSSGVTIYFGATRLSQAQF----TVTVGTSEYVTGNQ------------ 106

  Fly   113 HCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTSPID---- 173
                       .:||:. |..:.:..|...:.||  .::...:.....|.:...||.:...    
  Fly   107 -----------HLALVR-VPRVGFSNRVNRVALP--SLRNRSQRYENWWANVCGWGVTTFSNGLT 157

  Fly   174 --LQVLYLQYVPHRECKALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLV-------------- 222
              ||.:.||.:.:.||.|...:....| ..:||.:..|...|.||:|.||:              
  Fly   158 DALQCVDLQIMSNNECIAFYGSTTVSD-QILCTRTPSGRSTCFGDAGSPLITKQDSTVVGISAFV 221

  Fly   223 -SNGYLVGLVNWGWPCATGVPDVHASVYFYRDWI 255
             |||           |..|:|...|.:....|||
  Fly   222 ASNG-----------CTLGLPAGFARITSALDWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 59/260 (23%)
Tryp_SPc 38..258 CDD:238113 61/261 (23%)
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 61/261 (23%)
Tryp_SPc 29..244 CDD:214473 59/259 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.