DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG33460

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster


Alignment Length:299 Identity:68/299 - (22%)
Similarity:122/299 - (40%) Gaps:61/299 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCG 65
            |:|.:.:.||....||      |..:|....:..:|..:..:.......|: .:|....|:..|.
  Fly     1 MNATLTISLLASYMLV------IYSDSVSANYLYEQCGLMREEFSTSLGPW-TALLHTDGSIFCA 58

  Fly    66 GAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGG---RYFLKAIHIHCNYDNPEMHNDIAL 127
            |.:|.:.|:||||.|:....:...:...|......|..   .|||    ::..::|..:.|:|.|
  Fly    59 GTLITDVFILTAASCIRPNAVKVRLGEFGRYPNELPEDHLVHYFL----MYRLFNNESLANNIGL 119

  Fly   128 LELVEPIAWDERTQPIPLPLVPMQPGDEVILT------GW--GSTVLWGTSPIDLQVLYLQYVPH 184
            |:|.:.:...:...|:   .:.:.|.::.:.|      .|  .|.|   :...:|:.:.:|..| 
  Fly   120 LKLTKRVQITDYIMPV---CIVLNPQNQQLSTMRFIGNAWMEDSNV---SLTKELRPIVIQSKP- 177

  Fly   185 RECKALLSNDEDCDVGHICTFSRLGEG---ACHGDSGGPLVSNG-YL---------VGLVNWGWP 236
            :.|..|....:.| .||        :|   :|.|.:|..|:.|. |:         :..|| ...
  Fly   178 KMCTNLDLYTQFC-AGH--------QGNLRSCDGLTGSALIQNSRYMNKYRHIQFGIATVN-DMD 232

  Fly   237 C--ATGVPDVHASVYFYRDWIRNVMSGNSKCTGFSSNQS 273
            |  :.|..||   :.||. ||::|:   |....:|:|:|
  Fly   233 CEESQGYTDV---LKFYW-WIQDVV---SLFNHYSTNES 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 52/243 (21%)
Tryp_SPc 38..258 CDD:238113 54/245 (22%)
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 54/233 (23%)
Tryp_SPc 44..249 CDD:214473 52/230 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.