DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG33465

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster


Alignment Length:284 Identity:73/284 - (25%)
Similarity:110/284 - (38%) Gaps:44/284 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGL---SGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAH 62
            ||.|:.|.|:||   .||..:...:.....|      .:.|.....|.: .||:..|:.. :...
  Fly     1 MSRVLSLALIGLVLCQGLAQLLDKKCHDPKT------SENINFNHGATE-TAPWMASIYK-NNQF 57

  Fly    63 SCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQ--------PGGRYFLKAIHIHCNYDNP 119
            .|.|.::::.||||||.|:...  ..|.|:.|  .|||        ...:|.:.....|.|:...
  Fly    58 ICDGTLVHKLFVLTAASCISKD--SQLYVLFG--MYNQYRDASQFFNNEQYGVAVALQHSNFRPN 118

  Fly   120 EMHNDIALLELVEPIAWDERTQPIPLPL---VPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQY 181
            ...|||.||.|...:......:||.:.|   |...|.:.....||.......:|.:...|...|.
  Fly   119 NGVNDIGLLRLYGEVTHYAHIRPICIILDHVVKSAPFERFEGFGWQQQGTEASSQVRQTVYLSQK 183

  Fly   182 VP---HRECKALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSN--------GYLVGLVNWGW 235
            .|   ||..:.|..|:     |..|..:| ....|..:||.||.::        ...||||::|.
  Fly   184 KPFECHRNGQLLPINE-----GQFCAGNR-DRSFCRSNSGSPLTADFTYGVKNITVQVGLVSYGS 242

  Fly   236 PCATGVPDVHASVYFYRDWIRNVM 259
            ...:.. .|:..|..::|||.|.:
  Fly   243 ELCSPT-SVYTDVVAFKDWIYNTV 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 60/239 (25%)
Tryp_SPc 38..258 CDD:238113 62/241 (26%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 59/229 (26%)
Tryp_SPc 46..261 CDD:214473 57/226 (25%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.