DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG32374

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster


Alignment Length:249 Identity:75/249 - (30%)
Similarity:113/249 - (45%) Gaps:31/249 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 NSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHC-VENAFIPWL 89
            |:.:.:.|...||:.|:..:...||||.:|. .:....||..|:|..::|||.|| :.|   |..
  Fly    62 NALEAQDYLPTRIVNGKKIKCSRAPYQCALH-YNNYFICGCVILNRRWILTAQHCKIGN---PGR 122

  Fly    90 VVVTGTNKYNQPGG--RYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQP 152
            ..|...:...:.||  |:..|.: .|.||....|.||:.:::|..|:......|.:.||....:.
  Fly   123 YTVRAGSTQQRRGGQLRHVQKTV-CHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKLPSTRTKR 186

  Fly   153 GDEVIL-TGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGH-----------ICTF 205
            ..:..| :|||.|   ..:..::| .||:.|  ..||.   :...|...:           ||. 
  Fly   187 FPKCYLASGWGLT---SANAQNVQ-RYLRGV--IVCKV---SRAKCQQDYRGTGIKIYKQMICA- 241

  Fly   206 SRLGEGACHGDSGGPLVSNGYLVGLVNWGWPCATG-VPDVHASVYFYRDWIRNV 258
            .|.....|.||||||||.||.|.|:.::|..||:. .|.|:.:|..|..||:.|
  Fly   242 KRKNRDTCSGDSGGPLVHNGVLYGITSFGIGCASAKYPGVYVNVLQYTRWIKKV 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 70/233 (30%)
Tryp_SPc 38..258 CDD:238113 71/235 (30%)
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 70/233 (30%)
Tryp_SPc 74..295 CDD:238113 71/235 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.